DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and svh-1

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_501379.2 Gene:svh-1 / 182375 WormBaseID:WBGene00006620 Length:951 Species:Caenorhabditis elegans


Alignment Length:249 Identity:82/249 - (32%)
Similarity:122/249 - (48%) Gaps:37/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIATAAHCVYNRE-AENFLVVAG- 89
            |:|||.:|......:...||.:::.    |..||..|||...:.|||||....| ..::.||.| 
 Worm   712 RVVGGFETVPGAFPWTAALRNKATK----AHHCGASILDKTHLITAAHCFEEDERVSSYEVVVGD 772

  Fly    90 -DDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPLPLDSFSTMEAIEIASEQP----- 148
             |:::...|..:..:.::..:.|| .....:|||::.:  |.|...|:     |.|  ||     
 Worm   773 WDNNQTDGNEQIFYLQRIHFYPLY-KDIFSHDIAILEI--PYPGIEFN-----EYA--QPICLPS 827

  Fly   149 -----AVGVQATISGWGYTKENGLS-SDQLQQVKVPIVDSEKC-QEAYYWRPISEGMLCAGLSEG 206
                 ..|.|..:||||   ..||. :::||...:||::...| ..:..:..:|....|||..||
 Worm   828 KDFVYTPGRQCVVSGWG---SMGLRYAERLQAALIPIINRFDCVNSSQIYSSMSRSAFCAGYLEG 889

  Fly   207 GKDACQGDSGGPLVVANK-----LAGIVSWGEGCARPNYPGVYANVAYYKDWIA 255
            |.|:||||||||.....:     |||::|||:|||:...||:|..||.|..||:
 Worm   890 GIDSCQGDSGGPFACRREDGAFVLAGVISWGDGCAQKKQPGIYTMVAPYLSWIS 943

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 80/246 (33%)
Tryp_SPc 28..257 CDD:238113 81/248 (33%)
svh-1NP_501379.2 KR 227..306 CDD:214527
LDLa 320..355 CDD:238060
PAN_AP_HGF 373..434 CDD:238532
LDLa 558..590 CDD:197566
SRCR_2 599..681 CDD:382996
Tryp_SPc 713..945 CDD:238113 81/248 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.