DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and try-1

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:240 Identity:88/240 - (36%)
Similarity:128/240 - (53%) Gaps:20/240 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIATAAHC-VYNREAENFLVVA 88
            |.|::||:::|.:...:.|||..|...     ..|||.::|...:.||||| ..:|...::.|..
 Worm    55 DHRLIGGSESSPHSWPWTVQLLSRLGH-----HRCGGSLIDPNFVLTAAHCFAKDRRPTSYSVRV 114

  Fly    89 GDDSRGGMNGVVVRVSKLIPHELYNSSTMDN-DIALVVVDPPLPLDSFSTMEAIEIASEQPAVGV 152
            |....|  :|...||:.:..|..||.....: |.|::.:.|  |:::.:|...|.:.| .|||..
 Worm   115 GGHRSG--SGSPHRVTAVSIHPWYNIGFPSSYDFAIMRIHP--PVNTSTTARPICLPS-LPAVEN 174

  Fly   153 Q-ATISGWGYTKE-NGLSSDQLQQVKVPIVDSEKCQEA--YYWRPISEGMLCAGLSEGGKDACQG 213
            : ..::|||.|.| :.||:..|:::.||::.:..|...  |..|.....|||||.|.|..|:|||
 Worm   175 RLCVVTGWGSTIEGSSLSAPTLREIHVPLLSTLFCSSLPNYIGRIHLPSMLCAGYSYGKIDSCQG 239

  Fly   214 DSGGPLVVAN----KLAGIVSWGEGCARPNYPGVYANVAYYKDWI 254
            ||||||:.|.    :|.|:||||.|||||..||||.||.....||
 Worm   240 DSGGPLMCARDGHWELTGVVSWGIGCARPGMPGVYGNVHSASTWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 85/236 (36%)
Tryp_SPc 28..257 CDD:238113 86/237 (36%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 86/236 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.