DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and TMPRSS11B

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_872308.2 Gene:TMPRSS11B / 132724 HGNCID:25398 Length:416 Species:Homo sapiens


Alignment Length:217 Identity:69/217 - (31%)
Similarity:104/217 - (47%) Gaps:31/217 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 CGGCILDAVTIATAAHCVYNRE-----AENFLVVAGDDSRGGMNGVVV-------RVSKLIPHEL 111
            ||..::.:..:.:||||...:.     ..||             |:||       :|..:|.||.
Human   210 CGASLISSRWLLSAAHCFAKKNNSKDWTVNF-------------GIVVNKPYMTRKVQNIIFHEN 261

  Fly   112 YNSSTMDNDIALVVVDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSSDQLQQVK 176
            |:|..:.:|||||.:...:....:.....:..|..:.:......::|||....||.....||:..
Human   262 YSSPGLHDDIALVQLAEEVSFTEYIRKICLPEAKMKLSENDNVVVTGWGTLYMNGSFPVILQEDF 326

  Fly   177 VPIVDSEKCQEAY-YWRPISEGMLCAGLSEGGKDACQGDSGGPLVVANK-----LAGIVSWGEGC 235
            :.|:|::.|..:| |...:::.|||||...|..||||.||||||...:.     |.||||||:||
Human   327 LKIIDNKICNASYAYSGFVTDTMLCAGFMSGEADACQNDSGGPLAYPDSRNIWHLVGIVSWGDGC 391

  Fly   236 ARPNYPGVYANVAYYKDWIAKQ 257
            .:.|.||||..|..|::||..:
Human   392 GKKNKPGVYTRVTSYRNWITSK 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 67/212 (32%)
Tryp_SPc 28..257 CDD:238113 69/215 (32%)
TMPRSS11BNP_872308.2 SEA 45..143 CDD:279699
Tryp_SPc 184..410 CDD:214473 67/212 (32%)
Tryp_SPc 185..413 CDD:238113 69/215 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5783
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.