DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Prss29

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:280 Identity:88/280 - (31%)
Similarity:142/280 - (50%) Gaps:32/280 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VILRILAVLFLLGIYAVSAQSDG------RIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGC 62
            :::::...||.||.......:.|      .||||.........:.|.||......:.:...|||.
Mouse     1 MLIQLCLTLFFLGCSIAGTPAPGPEGVLMGIVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNCGGS 65

  Fly    63 ILDAVTIATAAHCVYNREAEN--FLVVAGDD-SRGGMNGVVVRVSKLIPHELYNSSTMDNDIALV 124
            |:....:.|||||:..|:|:.  |.:..|:. ..||..  ::.||::|.|..:..:.:.:|:||:
Mouse    66 IIHPQWVLTAAHCIRERDADPSVFRIRVGEAYLYGGKE--LLSVSRVIIHPDFVHAGLGSDVALL 128

  Fly   125 VVDPPLPLDSFSTMEAIEIASEQPAVGVQ--ATISGWG--YTKENGLSSDQLQQVKVPIVDSEKC 185
            .:  .:.:.||..::.:::.||...|..:  ..::|||  .|..:.....:||||:|.|:|:..|
Mouse   129 QL--AVSVQSFPNVKPVKLPSESLEVTKKDVCWVTGWGAVSTHRSLPPPYRLQQVQVKIIDNSLC 191

  Fly   186 QEAYY---------WRPISEGMLCAGLSEGGKDACQGDSGGPLVV----ANKLAGIVSWGEGCAR 237
            :|.|:         .:.|.:.|||||  ..|:|:|.||||||||.    :..|.|:||||.|||.
Mouse   192 EEMYHNATRHRNRGQKLILKDMLCAG--NQGQDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCAL 254

  Fly   238 PNYPGVYANVAYYKDWIAKQ 257
            .::|||||.|..:..||.:|
Mouse   255 RDFPGVYARVQSFLPWITQQ 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 80/246 (33%)
Tryp_SPc 28..257 CDD:238113 82/248 (33%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 82/248 (33%)
Tryp_SPc 31..271 CDD:214473 80/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.