DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Prss28

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:296 Identity:91/296 - (30%)
Similarity:136/296 - (45%) Gaps:69/296 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNKVILRILAVL----FLLGIYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGG 61
            |.:::|..|:.|    |:..: ::|......||||..|......:.|.||..|...:|:...|||
Mouse     1 MFRLLLLALSCLESTVFMASV-SISRSKPVGIVGGQCTPPGKWPWQVSLRMYSYEVNSWVHICGG 64

  Fly    62 CILDAVTIATAAHCVYNREAEN--FLVVAGDDSRGGMNGV-------VVRVSKLIPHELYNSSTM 117
            .|:....|.|||||:.:::|:.  :.|..|:        |       ::.:|::|.|..||..:.
Mouse    65 SIIHPQWILTAAHCIQSQDADPAVYRVQVGE--------VYLYKEQELLNISRIIIHPDYNDVSK 121

  Fly   118 DNDIALVV----------VDP-PLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLS--- 168
            ..|:||:.          |.| .||.|| ||.::.:          |..:.|||    |.|.   
Mouse   122 RFDLALMQLTALLVTSTNVSPVSLPKDS-STFDSTD----------QCWLVGWG----NLLQRVP 171

  Fly   169 ---SDQLQQVKVPIVDSEKCQEAYYWR--------PISEGMLCAGLSEGGKDACQGDSGGPLVV- 221
               ..||.:||:||.|::.|:.||..:        .|.:.|||||.|  |:..|.||||||||. 
Mouse   172 LQPPYQLHEVKIPIQDNKSCKRAYRKKSSDEHKAVAIFDDMLCAGTS--GRGPCFGDSGGPLVCW 234

  Fly   222 -ANK--LAGIVSWGEGCARPNYPGVYANVAYYKDWI 254
             :||  ..|:||.|..|:. |.|.:::.|.....||
Mouse   235 KSNKWIQVGVVSKGIDCSN-NLPSIFSRVQSSLAWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 83/264 (31%)
Tryp_SPc 28..257 CDD:238113 85/265 (32%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 85/265 (32%)
Tryp_SPc 31..269 CDD:214473 83/263 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.