DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Try5

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001003405.1 Gene:Try5 / 103964 MGIID:102756 Length:246 Species:Mus musculus


Alignment Length:254 Identity:94/254 - (37%)
Similarity:132/254 - (51%) Gaps:26/254 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AVLFLLGIYAVSA---QSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIAT 71
            ::|||..:.|..|   ..|.:||||.........|.|.|      :|.| ..|||.:::...:.:
Mouse     3 SLLFLALVGAAVAFPVDDDDKIVGGYTCRENSIPYQVSL------NSGY-HFCGGSLINDQWVVS 60

  Fly    72 AAHCVYNR-----EAENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPLP 131
            ||||...|     ...|..|:.|::.       .|..:|:|.|..:||.|::|||.|:.:..|:.
Mouse    61 AAHCYKTRIQVRLGEHNINVLEGNEQ-------FVNSAKIIKHPNFNSRTLNNDIMLIKLASPVT 118

  Fly   132 LDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSS-DQLQQVKVPIVDSEKCQEAYYWRPIS 195
            |:  :.:..:.:.|.....|.|..|||||.|...|::: |.||.:..|::....| ||.|...|:
Mouse   119 LN--ARVATVALPSSCAPAGTQCLISGWGNTLSFGVNNPDLLQCLDAPLLPQADC-EASYPGKIT 180

  Fly   196 EGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYKDWI 254
            ..|:|.|..|||||:||||||||:|...:|.||||||.|||..:.||||..|..|.|||
Mouse   181 NNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 86/232 (37%)
Tryp_SPc 28..257 CDD:238113 88/233 (38%)
Try5NP_001003405.1 Tryp_SPc 23..239 CDD:214473 86/232 (37%)
Tryp_SPc 24..242 CDD:238113 88/233 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.