DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and prss59.2

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001268923.1 Gene:prss59.2 / 100535672 ZFINID:ZDB-GENE-110408-10 Length:242 Species:Danio rerio


Alignment Length:257 Identity:89/257 - (34%)
Similarity:137/257 - (53%) Gaps:28/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LRILAVLFLLGIYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIA 70
            :|.|..|.|||  |..|..|.:||||.:.......:      ::|.:|.| ..|||.::....:.
Zfish     1 MRSLVFLVLLG--AAFALDDDKIVGGYECQPNSQPW------QASLNSGY-HFCGGSLVSEYWVV 56

  Fly    71 TAAHCVYNR-----EAENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPL 130
            :||||..:|     ...|.::..|.:.       .:...|:|.:..|:|.|:|:||.|:.:..|.
Zfish    57 SAAHCYKSRLEVRLGEHNIVINEGTEQ-------FITSEKVIRNPNYDSWTIDSDIMLIKLSKPA 114

  Fly   131 PLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSSDQLQQVKVPIVDSEKCQEAYYWRP-- 193
            .|:.:  ::.:.:.:...|.|....:||||.|..:...|::||.:::||:....|:.:|   |  
Zfish   115 TLNKY--VQPVALPNGCAADGTMCRVSGWGNTMSSTADSNKLQCLEIPILSDRDCKNSY---PGM 174

  Fly   194 ISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYKDWIA 255
            |::.|.|||..|||||:||||||||:|...:|.||||||.|||:.:.||||..|..:..|||
Zfish   175 ITDTMFCAGYLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQKDNPGVYGKVCMFSQWIA 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 77/233 (33%)
Tryp_SPc 28..257 CDD:238113 80/235 (34%)
prss59.2NP_001268923.1 Tryp_SPc 20..235 CDD:214473 77/233 (33%)
Tryp_SPc 21..238 CDD:238113 80/235 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.