DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and LOC100498532

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001333498.1 Gene:LOC100498532 / 100498532 -ID:- Length:251 Species:Xenopus tropicalis


Alignment Length:255 Identity:88/255 - (34%)
Similarity:122/255 - (47%) Gaps:23/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVLFLLGIYAVSA--QSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIAT 71
            |.||..|.:.|.:.  ..|.:||||.:.:.:...:.|.......:      .|||.::....|.:
 Frog     4 LWVLMFLAVAAAAPLDDDDDKIVGGYECTPHSQPWQVLFTYNGGN------WCGGSLISPRWIIS 62

  Fly    72 AAHCVYNREAENFLVVAGDDSRGGMNGVV--VRVSKLIPHELYNSSTMDNDIALVVVDPPLPLDS 134
            ||||.  :..:..:.:.|:.......|..  ::|.....|..|.....|:||.||.:..|...:.
 Frog    63 AAHCY--QPPKTLVALLGEHDLKKKEGTEQHIQVEAAYKHFGYKDKAHDHDIMLVKLAKPAQYNQ 125

  Fly   135 FSTMEAIEIASEQPAVGVQATISGW----GYTKENGLSSDQLQQVKVPIVDSEKCQEAYYWRPIS 195
            :  ::.|.:|...|..|.:..:||:    ||   |....||||.::||||....| :|.|.|.||
 Frog   126 Y--VQPIPVARSCPTDGAKCLVSGFGNVLGY---NVRYPDQLQCLEVPIVSDSSC-KASYPRMIS 184

  Fly   196 EGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEG-CARPNYPGVYANVAYYKDWI 254
            |.|.|||..||||.:|.|||||||:...:|.|.||||.. |...|.|||||.|..|.|||
 Frog   185 ENMFCAGFLEGGKGSCHGDSGGPLICNGELYGAVSWGGSYCISKNSPGVYAKVCNYLDWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 80/233 (34%)
Tryp_SPc 28..257 CDD:238113 82/234 (35%)
LOC100498532NP_001333498.1 Tryp_SPc 25..247 CDD:238113 82/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.