DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and f12

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_017947702.2 Gene:f12 / 100493769 XenbaseID:XB-GENE-1004811 Length:597 Species:Xenopus tropicalis


Alignment Length:254 Identity:90/254 - (35%)
Similarity:115/254 - (45%) Gaps:45/254 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGADTSSYYTKYVVQLRRRSSSSSSYAQT--CGGCILDAVTIATAAHCVYNR-EAENFLVVA 88
            |||||.........|:..|         |...  |||.::....|.|||||:..| ......||.
 Frog   358 RIVGGLVALPASHPYIAAL---------YIDNHFCGGSLISPCWIVTAAHCLDQRPNVTKISVVL 413

  Fly    89 GDD--SRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVD--------------PPLPL-DSFS 136
            |..  :....:.|.:.|.|.|.||.|...|:.:|||||.|.              .|:.| ..|.
 Frog   414 GQSRFNTTDQHTVTLLVEKYILHEKYYGDTLQHDIALVKVKSINGLCASEFSQFVQPICLPQQFK 478

  Fly   137 TMEAIEIASEQPAVGVQATISGWGYTKENGLS-SDQLQQVKVPIVDSEKCQE-AYYWRPISEGML 199
            ..|:.:          |..::|||:..|.... :..||:..:||:...:||. :.:...:..|||
 Frog   479 MAESTK----------QCVVAGWGHQYEGAEHYAFFLQEASMPIIPYTQCQSPSVHGDRMLPGML 533

  Fly   200 CAGLSEGGKDACQGDSGGPLVV----ANKLAGIVSWGEGCARPNYPGVYANVAYYKDWI 254
            |||..|||.||||||||||||.    ..:|.|:||||.|||..|.||||..|..|.|||
 Frog   534 CAGFMEGGVDACQGDSGGPLVCEVDGRIELHGVVSWGSGCAEENKPGVYTAVTSYTDWI 592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 88/252 (35%)
Tryp_SPc 28..257 CDD:238113 89/253 (35%)
f12XP_017947702.2 fn2 46..87 CDD:394995
EGF_CA 95..129 CDD:238011
KR 213..298 CDD:214527
Tryp_SPc 359..595 CDD:238113 89/253 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.