DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and LOC100485189

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_002941065.2 Gene:LOC100485189 / 100485189 -ID:- Length:249 Species:Xenopus tropicalis


Alignment Length:263 Identity:92/263 - (34%)
Similarity:124/263 - (47%) Gaps:41/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILAVLFLLGIYAVSAQSDGRIVGGAD---------TSSYYTKYVVQLRRRSSSSSSYAQTCGGCI 63
            ||.|..|||. ||.|:...||:||.:         .|.||....|               |||.:
 Frog     3 ILFVSALLGT-AVQARYYDRIIGGTECRPNSQPWHCSLYYFDQHV---------------CGGVL 51

  Fly    64 LDAVTIATAAHCVYN----REAE-NFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIAL 123
            :|...:.|||||..:    |..| |..|..|.:.       .....|:.||..:|..|.||||.|
 Frog    52 IDENWVLTAAHCQLSSLQVRLGEHNLAVYEGKEQ-------FSYAEKMCPHSGFNPITFDNDIML 109

  Fly   124 VVVDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWG-YTKENGLSSDQLQQVKVPIVDSEKCQE 187
            :.:..|:.::.:  ::.|.:.......|....:|||| .|.......|:||.|:|..|..:.||.
 Frog   110 LKLVSPVTINDY--VQTIPLGCPTVGDGETCLVSGWGTTTSPEETFPDELQCVEVQTVSQDYCQG 172

  Fly   188 AYYWRPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGE-GCARPNYPGVYANVAYYK 251
            |:....|::.|||||:.|||||:||||||||||..:.:.||.|||. .|...|.||:|..:..|.
 Frog   173 AFPTDEITDNMLCAGVMEGGKDSCQGDSGGPLVCNSMVHGITSWGNTPCGVANKPGIYTKICNYI 237

  Fly   252 DWI 254
            .||
 Frog   238 AWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 81/242 (33%)
Tryp_SPc 28..257 CDD:238113 82/243 (34%)
LOC100485189XP_002941065.2 Tryp_SPc 22..243 CDD:238113 82/243 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.