DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and zgc:171509

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001307362.1 Gene:zgc:171509 / 100141339 ZFINID:ZDB-GENE-080219-48 Length:240 Species:Danio rerio


Alignment Length:258 Identity:83/258 - (32%)
Similarity:136/258 - (52%) Gaps:29/258 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNKVILRILAVLFLLGIYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILD 65
            ||.::.     :.|:|: .|.::.| :|:||.:...:...:..:|      ...|. .|||.::.
Zfish     1 MNSIVF-----ILLIGV-VVHSKGD-KIIGGHECQPHSQPWQARL------DDGYG-LCGGSLIH 51

  Fly    66 AVTIATAAHC----VYNREAENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVV 126
            ...:.:||||    :.....::.|.|..|.::      .::..|:|.|..||:...:|||.|:.:
Zfish    52 ESWVVSAAHCKSSSIIVHLGKHDLFVVEDTAQ------EIQAEKVISHPKYNNREHNNDIMLIKL 110

  Fly   127 DPPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSSDQLQQVKVPIVDSEKCQEAYYW 191
            ..|..::  :.::.:.:.:.....|.|..:||||.|.::  .|..||.:::||:....|:.| |.
Zfish   111 REPAVIN--NNVKPVPLPTNCSHAGEQCLVSGWGVTGDS--ISSTLQCLELPILSKADCKSA-YG 170

  Fly   192 RPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYKDWI 254
            |.|::.|.|||..:||||:||||||||:|....|.||||:|.|||.|.:||||..|..|.:||
Zfish   171 RVITKKMFCAGFMDGGKDSCQGDSGGPVVCNGTLKGIVSFGIGCAEPGFPGVYVEVCRYINWI 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 75/230 (33%)
Tryp_SPc 28..257 CDD:238113 77/231 (33%)
zgc:171509NP_001307362.1 Tryp_SPc 20..233 CDD:214473 75/230 (33%)
Tryp_SPc 21..234 CDD:238113 77/231 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.