DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Gm2663

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001096130.1 Gene:Gm2663 / 100040208 MGIID:3780832 Length:247 Species:Mus musculus


Alignment Length:249 Identity:84/249 - (33%)
Similarity:122/249 - (48%) Gaps:24/249 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FLLGIYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIATAAHCVY 77
            ||....|:.|.||.:||||.....:...|.|.|      :...:..|||.:::...:.:|||| |
Mouse     9 FLGAAVALPANSDDKIVGGYTCPKHSVPYQVSL------NDGISHQCGGSLINDQWVLSAAHC-Y 66

  Fly    78 NREAE------NFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPLPLDSFS 136
            .|..:      |..|:.|.:.       .:...|:|.|..||..|:||||.|:.:..|..|:  |
Mouse    67 KRRLQVRLGEHNIDVLEGGEQ-------FIDAEKIIRHPDYNKDTVDNDIMLIKLKSPAILN--S 122

  Fly   137 TMEAIEIASEQPAVGVQATISGWGYTKE-NGLSSDQLQQVKVPIVDSEKCQEAYYWRPISEGMLC 200
            .:..:.:.....:...|..:||||.|.. .|.....||.::.|::.:..|:::|..: |:..|.|
Mouse   123 QVSTVSLPRSCASTNAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQ-ITSNMFC 186

  Fly   201 AGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYKDWI 254
            .|..|||||:|.||||||:|...::.||||||..||....||||..|..|..||
Mouse   187 LGFLEGGKDSCDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 76/233 (33%)
Tryp_SPc 28..257 CDD:238113 78/234 (33%)
Gm2663NP_001096130.1 Tryp_SPc 23..240 CDD:214473 76/233 (33%)
Tryp_SPc 24..243 CDD:238113 78/234 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.