DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and TMPRSS11D

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_004253.1 Gene:TMPRSS11D / 9407 HGNCID:24059 Length:418 Species:Homo sapiens


Alignment Length:283 Identity:88/283 - (31%)
Similarity:134/283 - (47%) Gaps:46/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSSWIVGLLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPEN 66
            :::|::........|:.|:               :.||:||...:....|:|:|||...      
Human   165 AANWLINECGAGPDLITLS---------------EQRILGGTEAEEGSWPWQVSLRLNN------ 208

  Fly    67 PFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAY 131
              .|.||||:.|...|:||||| ..:.::....:|.:...|....:...|:.|::|..|.| |.:
Human   209 --AHHCGGSLINNMWILTAAHC-FRSNSNPRDWIATSGISTTFPKLRMRVRNILIHNNYKS-ATH 269

  Fly   132 NNDIAILFVDPPLPLNNFTIK------AIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDV 190
            .||||::.::     |:.|..      .:..|.:....|:.:.|:|||.....|::..:|....|
Human   270 ENDIALVRLE-----NSVTFTKDIHSVCLPAATQNIPPGSTAYVTGWGAQEYAGHTVPELRQGQV 329

  Fly   191 PIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDE-----LYGVVSW 250
            .|:||::|:..:...|    .|.|.|||||. ..||.|||||||||||...|.     :.|:|||
Human   330 RIISNDVCNAPHSYNG----AILSGMLCAGV-PQGGVDACQGDSGGPLVQEDSRRLWFIVGIVSW 389

  Fly   251 GNSCALPNYPGVYANVAYLRPWI 273
            |:.|.||:.||||..|.....||
Human   390 GDQCGLPDKPGVYTRVTAYLDWI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 83/245 (34%)
Tryp_SPc 39..276 CDD:238113 84/246 (34%)
TMPRSS11DNP_004253.1 SEA 48..143 CDD:279699
Tryp_SPc 186..412 CDD:214473 83/245 (34%)
Tryp_SPc 187..415 CDD:238113 84/246 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.