DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Prss12

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_445956.1 Gene:Prss12 / 85266 RGDID:69238 Length:761 Species:Rattus norvegicus


Alignment Length:256 Identity:83/256 - (32%)
Similarity:122/256 - (47%) Gaps:30/256 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCV--IGTVASQYKVV 100
            ||:||..:.....|:|.|||.|   :.....|..||.::.:...::|||||.  .|..:..|.|.
  Rat   516 RIIGGNNSLRGAWPWQASLRLK---STHGDGRLLCGATLLSSCWVLTAAHCFTRYGNNSRSYAVR 577

  Fly   101 AGTNFQTGSDGVITN--VKEIVMHEGYYSGAAYNNDIAILFV----DPPLPLNNFTIKA-IKLAL 158
            .|.......:|...:  |::||:|..|...:: :.|||::.:    :....|:...:.| :.|..
  Rat   578 VGDYHTLVPEGFEQDIGVQQIVIHRNYRPDSS-DYDIALVRLQGSGEQCARLSTHVLPACLPLWR 641

  Fly   159 EQPIEGTVSK--VSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGK 221
            |:| :.|.|.  ::|||.|  |...|..|....||::....|.:.|:..      .|..|||||.
  Rat   642 ERP-QKTASNCHITGWGDT--GRAYSRTLQQAAVPLLPKRFCKERYKGL------FTGRMLCAGN 697

  Fly   222 -RGVGGADACQGDSGGPLAVR--DE---LYGVVSWGNSCALPNYPGVYANVAYLRPWIDAV 276
             :.....|:|||||||||...  ||   :|||.|||..|.:.:.||||..|....|||.:|
  Rat   698 LQEDNRVDSCQGDSGGPLMCEKPDETWVVYGVTSWGYGCGIKDTPGVYTRVPAFVPWIKSV 758

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 80/251 (32%)
Tryp_SPc 39..276 CDD:238113 81/253 (32%)
Prss12NP_445956.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..89
KR 83..159 CDD:214527
SR 166..265 CDD:214555
SRCR 171..266 CDD:278931
SR 273..372 CDD:214555
SRCR 278..371 CDD:278931
SR 386..485 CDD:214555
SRCR 391..485 CDD:278931
Zymogen activation region. /evidence=ECO:0000250 505..516 83/256 (32%)
Tryp_SPc 516..755 CDD:214473 80/251 (32%)
Tryp_SPc 517..758 CDD:238113 81/253 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.