DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Plg

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_445943.1 Gene:Plg / 85253 RGDID:619893 Length:812 Species:Rattus norvegicus


Alignment Length:276 Identity:93/276 - (33%)
Similarity:141/276 - (51%) Gaps:47/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISL--RYKGITTPENPFRHRCGGSIF 77
            ||.:...|.|.:|   .|..| ||:|||...:....|:||||  |:.|        :|.|||::.
  Rat   562 SLSSFECGKPQVE---PKKCP-GRVVGGCVANPHSWPWQISLRTRFSG--------QHFCGGTLI 614

  Fly    78 NETTIVTAAHCVIGTVASQ-YKVVAGTNFQ--TGSDGVITNVKEIVMHEGYYSGAAYNNDIAILF 139
            :...::|||||:..:...: |||:.|.:.:  .|||.....|.::|:...       :.|||:|.
  Rat   615 SPEWVLTAAHCLEKSSRPEFYKVILGAHEERILGSDVQQIAVTKLVLEPN-------DADIALLK 672

  Fly   140 VDPPLPLNNFTIKAIKLALEQP----IEGTVSKVSGWGTT--SPGGYSSNQLLAVDVPIVSNELC 198
            :..|..:.:..|.|   .|..|    .:.|:..::|||.|  :||   :.:|....:|::.|::|
  Rat   673 LSRPATITDNVIPA---CLPSPNYVVADRTLCYITGWGETKGTPG---AGRLKEAQLPVIENKVC 731

  Fly   199 DQ-DYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDE----LYGVVSWGNSCALPN 258
            :: :|.:     .|:.|..||||.. .||.|:|||||||||...::    |.||.|||..||.||
  Rat   732 NRAEYLN-----NRVKSTELCAGHL-AGGIDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPN 790

  Fly   259 YPGVYANVAYLRPWID 274
            .||||..|:....||:
  Rat   791 KPGVYVRVSRYVNWIE 806

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 83/250 (33%)
Tryp_SPc 39..276 CDD:238113 84/252 (33%)
PlgNP_445943.1 PAN_AP_HGF 33..97 CDD:238532
KR 101..183 CDD:214527
KR 183..262 CDD:214527
KR 273..354 CDD:214527
KR 374..456 CDD:214527
KR 480..562 CDD:214527 93/276 (34%)
Tryp_SPc 581..805 CDD:214473 83/250 (33%)
Tryp_SPc 582..807 CDD:238113 84/252 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.