DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and TMPRSS13

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001070731.1 Gene:TMPRSS13 / 84000 HGNCID:29808 Length:567 Species:Homo sapiens


Alignment Length:252 Identity:85/252 - (33%)
Similarity:124/252 - (49%) Gaps:36/252 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGT---VASQYK 98
            ||||||.....::.|:|:||.: |.|       |.|||::.:...::|||||...|   |...:|
Human   324 GRIVGGALASDSKWPWQVSLHF-GTT-------HICGGTLIDAQWVLTAAHCFFVTREKVLEGWK 380

  Fly    99 VVAGT-NFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPI 162
            |.||| |.....:.  .::.||:::.. |:....:.|||::.:..||.|:.....|.     .|:
Human   381 VYAGTSNLHQLPEA--ASIAEIIINSN-YTDEEDDYDIALMRLSKPLTLSAHIHPAC-----LPM 437

  Fly   163 EGTVSK------VSGWG-TTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAG 220
            .|....      ::|:| |......:|..|..|.|.::..:.|: ||..:  ::| :|..|:|||
Human   438 HGQTFSLNETCWITGFGKTRETDDKTSPFLREVQVNLIDFKKCN-DYLVY--DSY-LTPRMMCAG 498

  Fly   221 KRGVGGADACQGDSGGPLAVRDE----LYGVVSWGNSCALPNYPGVYANVAYLRPWI 273
            ... ||.|:|||||||||.....    |.||.|||..|...|.||||..|..:.|||
Human   499 DLR-GGRDSCQGDSGGPLVCEQNNRWYLAGVTSWGTGCGQRNKPGVYTKVTEVLPWI 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 82/249 (33%)
Tryp_SPc 39..276 CDD:238113 83/250 (33%)
TMPRSS13NP_001070731.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115
13 X 5 AA repeats of A-S-P-A-[GLQR] 9..93
4 X 5 AA repeats of T-P-P-G-R 14..68
DUF3682 16..>87 CDD:289231
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 131..157
SRCR_2 231..320 CDD:292133
Tryp_SPc 325..554 CDD:214473 82/249 (33%)
Tryp_SPc 326..557 CDD:238113 83/250 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.