DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and TMPRSS5

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_110397.2 Gene:TMPRSS5 / 80975 HGNCID:14908 Length:457 Species:Homo sapiens


Alignment Length:251 Identity:101/251 - (40%)
Similarity:129/251 - (51%) Gaps:34/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIG---TVASQYKV 99
            |||||.:....:.|:|.|:..        .|||.||||:.....:||||||:..   ...|.::|
Human   217 RIVGGQSVAPGRWPWQASVAL--------GFRHTCGGSVLAPRWVVTAAHCMHSFRLARLSSWRV 273

  Fly   100 VAGTNFQTG---SDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNF--TIKAIKL-AL 158
            .||....:.   ..|.:  |:.|:.|. .||...::.|:|:|.:...|   ||  |:.|:.| |.
Human   274 HAGLVSHSAVRPHQGAL--VERIIPHP-LYSAQNHDYDVALLRLQTAL---NFSDTVGAVCLPAK 332

  Fly   159 EQPI-EGTVSKVSGWGTTSPG-GYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGK 221
            ||.. :|:...|||||.|.|. .|||:.|....||:.|.:||:......|    .:|..|||||.
Human   333 EQHFPKGSRCWVSGWGHTHPSHTYSSDMLQDTVVPLFSTQLCNSSCVYSG----ALTPRMLCAGY 393

  Fly   222 RGVGGADACQGDSGGPLAVRD----ELYGVVSWGNSCALPNYPGVYANVAYLRPWI 273
            .. |.||||||||||||...|    .|.||||||..||.||:|||||.||....||
Human   394 LD-GRADACQGDSGGPLVCPDGDTWRLVGVVSWGRGCAEPNHPGVYAKVAEFLDWI 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 99/249 (40%)
Tryp_SPc 39..276 CDD:238113 100/250 (40%)
TMPRSS5NP_110397.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
SRCR_2 116..213 CDD:292133
Tryp_SPc 217..448 CDD:214473 99/249 (40%)
Tryp_SPc 218..451 CDD:238113 100/250 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.