DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Prss36

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:287 Identity:91/287 - (31%)
Similarity:133/287 - (46%) Gaps:44/287 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AFLVSLVALTQGLPLLEDLD-EKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGG 74
            ||..|:|:.|||  ..|||| .:..|..|||||........|:|:||...|        .|.|||
Mouse    21 AFQDSVVSPTQG--EFEDLDCGRPEPSSRIVGGSDAHPGTWPWQVSLHQGG--------GHICGG 75

  Fly    75 SIFNETTIVTAAHCVI--GTV--ASQYKVVAGTNFQTGS-DGV-ITNVKEIVMHEGYYSGAAYNN 133
            |:...:.:::||||.:  ||:  |.:..|:.|.:.|.|. :|. :.:|..|::.:. ||......
Mouse    76 SLIAPSWVLSAAHCFVTNGTLEPADELSVLLGVHSQDGPLEGAHMRSVATILIPDN-YSTVELGA 139

  Fly   134 DIAILFVDPPLPLNNFTIKAIKLALEQPI--EGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNE 196
            |:|:|.:..|..|.. :::.:.|.....:  .||....:|||..       .:.:.:.:|.|..|
Mouse   140 DLALLRLASPAKLGP-SVRPVCLPRASHLFAHGTACWATGWGDV-------QEAVPLPLPWVLQE 196

  Fly   197 L---------CDQDYEDFG--DETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDE----LYG 246
            :         |...|...|  :.|:::...||||| ...|..|.|||||||||...|.    |.|
Mouse   197 VELRLLGEAACQCLYSRPGPFNLTFQLLPGMLCAG-YPAGRRDTCQGDSGGPLVCEDGGRWFLAG 260

  Fly   247 VVSWGNSCALPNYPGVYANVAYLRPWI 273
            :.|:|..|...|.|||:..||....||
Mouse   261 ITSFGFGCGRRNRPGVFTAVAPYESWI 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 77/257 (30%)
Tryp_SPc 39..276 CDD:238113 78/258 (30%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 78/258 (30%)
Tryp_SPc 331..532 CDD:389826
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839476
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.