DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and 1810009J06Rik

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_076196.1 Gene:1810009J06Rik / 73626 MGIID:1920876 Length:247 Species:Mus musculus


Alignment Length:288 Identity:89/288 - (30%)
Similarity:126/288 - (43%) Gaps:60/288 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IVGLLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRH 70
            |:....||.:.|||...            .|.:|||||......||||:||. .||:       |
Mouse     3 IITFFTFLGAAVALPAN------------SDDKIVGGYTCPKHSVPYQVSLN-DGIS-------H 47

  Fly    71 RCGGSIFNETTIVTAAHCVIGTVASQYK--------------VVAGTNFQTGSDGVITNVKEIVM 121
            :||||:.::..:::||||        ||              :..|..|        .:.::|:.
Mouse    48 QCGGSLISDQWVLSAAHC--------YKRRLQVRLGEHNIDVLEGGEQF--------IDAEKIIR 96

  Fly   122 HEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWG-TTSPGGYSSNQL 185
            |..|..... :|||.::.:..|..||: .:..:.|............||||| |.|.||.....|
Mouse    97 HPDYNKDTV-DNDIMLIKLKSPAILNS-QVSTVSLPRSCASTNAQCLVSGWGNTVSIGGKYPALL 159

  Fly   186 LAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSW 250
            ..::.|::|...|.:.|..      :|||.|.|.|.. .||.|:|.||||||:....|:.|:|||
Mouse   160 QCLEAPVLSASSCKKSYPG------QITSNMFCLGFL-EGGKDSCDGDSGGPVVCNGEIQGIVSW 217

  Fly   251 GNSCALPNYPGVYANVAYLRPWIDAVLA 278
            |:.||:...||||..|.....||...:|
Mouse   218 GSVCAMRGKPGVYTKVCNYLSWIQETMA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 79/249 (32%)
Tryp_SPc 39..276 CDD:238113 81/251 (32%)
1810009J06RikNP_076196.1 Tryp_SPc 23..240 CDD:214473 79/249 (32%)
Tryp_SPc 24..243 CDD:238113 81/251 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.