DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and XB5723326

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001037931.1 Gene:XB5723326 / 733551 XenbaseID:XB-GENE-5723327 Length:349 Species:Xenopus tropicalis


Alignment Length:254 Identity:67/254 - (26%)
Similarity:115/254 - (45%) Gaps:32/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 IVGGYATDIAQV----PYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCV----IGTVAS 95
            :...|:|::..|    |:.:|::.|    .|..::|.|.|:|.|...|:|||||.    .|...:
 Frog    12 VKASYSTELNPVEGKWPWIVSIQKK----VELGYKHICAGTILNNEWIITAAHCFKDWKEGDPTT 72

  Fly    96 QYKVVAGTNFQTGSDGVIT---NVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLA 157
            ..:|:.|| |.....|:.|   .||:::.|: .|.....:||||::.:|..:..::...:|....
 Frog    73 PLRVLLGT-FYLSEIGLRTQSRGVKQLIKHD-QYDPITESNDIALIQLDKQVEFSDHIQQACFPK 135

  Fly   158 LEQPIEGTVS-KVSGWGTTSPGGYSSNQLL-AVDVPIVSNELCDQDYEDFGDETYRITSAMLCAG 220
            ....::..:. .::|||.........:|.| ...|..:..:.|::.|:....|.:      ||||
 Frog   136 ESADLKDLIDCSIAGWGAQGKHLDEPSQFLQEAQVERIDTKHCNKWYQGILGENH------LCAG 194

  Fly   221 KRGVGGADACQGDSGGPLAVRDE------LYGVVSWGNSCALPNYPGVYANVAYLRPWI 273
            .| .|....|.||.|.||..|.:      :.|:::||:.|.....||||:.:.....||
 Frog   195 HR-KGPEKTCNGDRGSPLMCRTKKNNVYSVIGILNWGSGCGQTRSPGVYSPIQSHIKWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 65/252 (26%)
Tryp_SPc 39..276 CDD:238113 67/254 (26%)
XB5723326NP_001037931.1 Tryp_SPc 25..252 CDD:214473 62/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.