DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and C1S

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001725.1 Gene:C1S / 716 HGNCID:1247 Length:688 Species:Homo sapiens


Alignment Length:299 Identity:86/299 - (28%)
Similarity:134/299 - (44%) Gaps:56/299 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSSWIVGLLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPEN 66
            :.||:..:|...:.......|:| .|..:||.    ||:||...||...|:|:..        :|
Human   406 NGSWVNEVLGPELPKCVPVCGVP-REPFEEKQ----RIIGGSDADIKNFPWQVFF--------DN 457

  Fly    67 PFRHRCGGSIFNETTIVTAAHCVIGT-VASQYKVVAGTNFQTG--SDGVITNVKEIVMHEGY--- 125
            |:   .||::.||..::||||.|.|. ..:.|  |..|:.||.  :...:...:.:.:|.|:   
Human   458 PW---AGGALINEYWVLTAAHVVEGNREPTMY--VGSTSVQTSRLAKSKMLTPEHVFIHPGWKLL 517

  Fly   126 ---YSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQP--------IEGTVSKVSGWGTTSPGG 179
               .....::||||::.:..|:.:.. |:..|.|    |        ::|.:..:||||.|....
Human   518 EVPEGRTNFDNDIALVRLKDPVKMGP-TVSPICL----PGTSSDYNLMDGDLGLISGWGRTEKRD 577

  Fly   180 YSSNQLLAVDVPIVSNELCDQ---DYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVR 241
             .:.:|.|..:|:.....|.:   :......|.|..|..|:|||  |..|.|:|:|||||..||:
Human   578 -RAVRLKAARLPVAPLRKCKEVKVEKPTADAEAYVFTPNMICAG--GEKGMDSCKGDSGGAFAVQ 639

  Fly   242 D-----ELY--GVVSWGNSCALPNYPGVYANVAYLRPWI 273
            |     :.|  |:||||..|.  .| |:|..|.....||
Human   640 DPNDKTKFYAAGLVSWGPQCG--TY-GLYTRVKNYVDWI 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 76/261 (29%)
Tryp_SPc 39..276 CDD:238113 77/262 (29%)
C1SNP_001725.1 CUB 18..129 CDD:238001
FXa_inhibition 143..171 CDD:405372
CUB 175..287 CDD:395345
CCP 294..355 CDD:153056
Sushi 359..421 CDD:395037 3/14 (21%)
Tryp_SPc 438..678 CDD:238113 77/262 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.