DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Prss55

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_036014741.1 Gene:Prss55 / 71037 MGIID:1918287 Length:347 Species:Mus musculus


Alignment Length:292 Identity:91/292 - (31%)
Similarity:129/292 - (44%) Gaps:42/292 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLAFLVSLVA-------LTQGLPLL-------EDLDEKSVPDGRIVGGYATDIAQVPYQISLRYK 59
            |||.|..||.       ||:.|..:       ..|.:..:...||:.|...::.:.|:|:|:   
Mouse    17 LLATLCRLVGHHIRDCILTECLLCIASSECGVRPLYDSRIQYSRIIEGQEAELGEFPWQVSI--- 78

  Fly    60 GITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVAS--QYKVVAGTNFQTGSDGVITNVKEIVMH 122
                 :....|.|||||.:|..|:|.|||......|  ..:|..|||..|.|. |...|..|:.|
Mouse    79 -----QESDHHFCGGSILSEWWILTVAHCFYAQELSPTDLRVRVGTNDLTTSP-VELEVTTIIRH 137

  Fly   123 EGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYS--SNQL 185
            :| :.....:||||:|.:..||..|..|:.........|.......|:|||.|:.....  |..|
Mouse   138 KG-FKRLNMDNDIALLLLAKPLTFNELTVPICLPLWPAPPSWHECWVAGWGVTNSTDKESMSTDL 201

  Fly   186 LAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDE------L 244
            :.|.:.|:..|.|.|.:..       :|:.|||| ..|....|||||||||||....:      .
Mouse   202 MKVPMRIIEWEECLQMFPS-------LTTNMLCA-SYGNESYDACQGDSGGPLVCTTDPGSRWYQ 258

  Fly   245 YGVVSWGNSCALPNYPGVYANVAYLRPWIDAV 276
            .|::|||.||....:||:|..:|....||:.:
Mouse   259 VGIISWGKSCGKKGFPGIYTVLAKYTLWIEKI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 79/244 (32%)
Tryp_SPc 39..276 CDD:238113 80/246 (33%)
Prss55XP_036014741.1 Tryp_SPc 60..287 CDD:214473 79/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.