DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Prss41

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001128559.1 Gene:Prss41 / 681033 RGDID:1584711 Length:324 Species:Rattus norvegicus


Alignment Length:326 Identity:89/326 - (27%)
Similarity:134/326 - (41%) Gaps:94/326 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLAFLVSLVALTQGLP---------LLEDLDEK--SVPDG-------RIVGGYATDIAQVPYQIS 55
            :|..|:.:|.:..|.|         .|::.|.|  |:|.|       |||||..:...:.|:|.|
  Rat     7 MLLLLLLVVCVMLGEPGSREENQAAGLKNTDIKLLSMPCGRRNDIRSRIVGGIESVRGRWPWQAS 71

  Fly    56 LRYKGITTPENPFRHRCGGSIFNETTIVTAAHCV------------IGTVAS------------Q 96
            ||.:..        ||||||:.:...::|||||.            :|.:.|            :
  Rat    72 LRLRKF--------HRCGGSLLSHRWVLTAAHCFRKFLDPKKWTVQLGQLTSKPSFWNREAFSGR 128

  Fly    97 YKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNF-----TIKAIKL 156
            |:|         .|.:|.:..::..|           |:|:|.:...:..|.|     .:.:..:
  Rat   129 YRV---------KDIIINSEDKLKYH-----------DLALLRLASSVTYNKFIQPVCVLPSASM 173

  Fly   157 ALEQPIEGTVSKVSGWGTTS------PGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSA 215
            :..||    ...|:|||...      |..|   .|..|.|.:::...| |:...|....:.||..
  Rat   174 SQHQP----RCWVTGWGALQEDLKPLPPPY---HLREVQVTVLNLSRC-QELFSFASRYHLITRD 230

  Fly   216 MLCAGKRGVGGADACQGDSGGPLAVR-DELY---GVVSWGNSCALPNYPGVYANVAYLRPWIDAV 276
            :.|||... |.||.|.|||||||... |.|:   |:||.|..|..|..||:|.||::...||..:
  Rat   231 VFCAGAED-GSADTCSGDSGGPLVCNMDGLWYQIGIVSRGVGCGRPKLPGIYTNVSHHYDWIKTM 294

  Fly   277 L 277
            :
  Rat   295 M 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 76/273 (28%)
Tryp_SPc 39..276 CDD:238113 77/275 (28%)
Prss41NP_001128559.1 Tryp_SPc 54..291 CDD:214473 76/273 (28%)
Tryp_SPc 55..292 CDD:238113 76/273 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.