DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and TMPRSS3

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_076927.1 Gene:TMPRSS3 / 64699 HGNCID:11877 Length:454 Species:Homo sapiens


Alignment Length:259 Identity:89/259 - (34%)
Similarity:123/259 - (47%) Gaps:53/259 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAG 102
            |||||..:.::|.|:|.||:::|.        |.||||:.....|:||||||......:     .
Human   216 RIVGGNMSLLSQWPWQASLQFQGY--------HLCGGSVITPLWIITAAHCVYDLYLPK-----S 267

  Fly   103 TNFQTGSDGVITN------VKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQP 161
            ...|.|...::.|      |::||.| ..|......||||::.:..||..|.         :.||
Human   268 WTIQVGLVSLLDNPAPSHLVEKIVYH-SKYKPKRLGNDIALMKLAGPLTFNE---------MIQP 322

  Fly   162 I----------EGTVSKVSGWGTTSPG-GYSSNQLLAVDVPIVSNELCDQDYEDFGDETYR--IT 213
            :          :|.|...||||.|..| |.:|..|....||::||::|:.      .:.|.  |:
Human   323 VCLPNSEENFPDGKVCWTSGWGATEDGAGDASPVLNHAAVPLISNKICNH------RDVYGGIIS 381

  Fly   214 SAMLCAGKRGVGGADACQGDSGGPLAVRD----ELYGVVSWGNSCALPNYPGVYANVAYLRPWI 273
            .:|||||.. .||.|:|||||||||..::    :|.|..|:|..||..|.||||..|.....||
Human   382 PSMLCAGYL-TGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRVTSFLDWI 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 87/257 (34%)
Tryp_SPc 39..276 CDD:238113 88/258 (34%)
TMPRSS3NP_076927.1 LDLa 74..107 CDD:238060
SRCR_2 112..210 CDD:292133
Tryp_SPc 216..444 CDD:214473 87/257 (34%)
Tryp_SPc 217..447 CDD:238113 88/258 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.