DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and PRSS22

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_071402.1 Gene:PRSS22 / 64063 HGNCID:14368 Length:317 Species:Homo sapiens


Alignment Length:266 Identity:79/266 - (29%)
Similarity:125/266 - (46%) Gaps:45/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQY--KVV 100
            |:|||..:..::.|:.:|::..|        .|.|.||:.....::|||||....:...|  .|:
Human    49 RVVGGEDSTDSEWPWIVSIQKNG--------THHCAGSLLTSRWVITAAHCFKDNLNKPYLFSVL 105

  Fly   101 AGTNFQTGSDGVITNVKEIVMHEGY--YS---GAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQ 160
            .|. :|.|:.|..:....:...|.:  ||   ||.  .|||::.::..:   .|:.:.:.:.|..
Human   106 LGA-WQLGNPGSRSQKVGVAWVEPHPVYSWKEGAC--ADIALVRLERSI---QFSERVLPICLPD 164

  Fly   161 PI----EGTVSKVSGWGTTSPGG--YSSNQLLAVDVPIVSNELCDQDYEDFGDETYR------IT 213
            ..    ..|...:||||:...|.  .....|..:.|||:.:|:|...|       :|      ||
Human   165 ASIHLPPNTHCWISGWGSIQDGVPLPHPQTLQKLKVPIIDSEVCSHLY-------WRGAGQGPIT 222

  Fly   214 SAMLCAGKRGVGGADACQGDSGGPLAVRDE----LYGVVSWGNSCALPNYPGVYANVAYLRPWID 274
            ..|||||.. .|..|||.|||||||..:.:    |.|::|||..||..|.||||.:::..|.|::
Human   223 EDMLCAGYL-EGERDACLGDSGGPLMCQVDGAWLLAGIISWGEGCAERNRPGVYISLSAHRSWVE 286

  Fly   275 AVLAGL 280
            .::.|:
Human   287 KIVQGV 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 77/257 (30%)
Tryp_SPc 39..276 CDD:238113 77/259 (30%)
PRSS22NP_071402.1 Tryp_SPc 50..288 CDD:238113 77/259 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.