DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CELA2A

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_254275.1 Gene:CELA2A / 63036 HGNCID:24609 Length:269 Species:Homo sapiens


Alignment Length:262 Identity:79/262 - (30%)
Similarity:129/262 - (49%) Gaps:43/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAG 102
            |:|||........|:|:||:|    :....:.|.||||:...:.::|||||:  :.:..|:|..|
Human    28 RVVGGEEARPNSWPWQVSLQY----SSNGKWYHTCGGSLIANSWVLTAAHCI--SSSRTYRVGLG 86

  Fly   103 TN--FQTGSDGVITNVKEIVMHEGYYSG-AAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIEG 164
            .:  :...|..:..:|.:||:|:.:.|. .:..||||:|.:..|:.|.:    .|:||...| .|
Human    87 RHNLYVAESGSLAVSVSKIVVHKDWNSNQISKGNDIALLKLANPVSLTD----KIQLACLPP-AG 146

  Fly   165 TV------SKVSGWGTTSPGG-----YSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLC 218
            |:      ..|:|||.....|     ....:||.||....|:...      :|..   :.::|:|
Human   147 TILPNNYPCYVTGWGRLQTNGAVPDVLQQGRLLVVDYATCSSSAW------WGSS---VKTSMIC 202

  Fly   219 AGKRGVGGADACQGDSGGPLAV-----RDELYGVVSWGN--SCALPNYPGVYANVAYLRPWIDAV 276
            ||  |.|...:|.|||||||..     |.:::|:||:|:  .|...:.|.|:..|:....||::|
Human   203 AG--GDGVISSCNGDSGGPLNCQASDGRWQVHGIVSFGSRLGCNYYHKPSVFTRVSNYIDWINSV 265

  Fly   277 LA 278
            :|
Human   266 IA 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 75/255 (29%)
Tryp_SPc 39..276 CDD:238113 76/257 (30%)
CELA2ANP_254275.1 Tryp_SPc 29..265 CDD:238113 76/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.