DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG17242

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:263 Identity:85/263 - (32%)
Similarity:128/263 - (48%) Gaps:32/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIV 83
            |.:|:.||..:.:.:. |.:.:|     |.|.|:|.|::...        :|.|||.|::|..|:
  Fly     2 LLKGILLLVSIAQIAA-DFKSIG-----IEQAPWQASVQIND--------KHHCGGVIYSEDIIL 52

  Fly    84 TAAHCVIGTVASQYKVVAGTNFQTGSDGVITNVKEI---VMHEGYYSGAAYNNDIAILFVDPPLP 145
            |.|.||.........|..| :.|..:.|.:..|:::   |:       ....:|:|||.:..||.
  Fly    53 TIAECVRKARLEFISVRVG-SAQENAGGTVLKVEKMRLQVL-------GLRPSDVAILQLRSPLY 109

  Fly   146 LNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETY 210
            |:. .|:||.||....:.||.:.|||||..|....||..||.|||.|....:|..:....|    
  Fly   110 LDG-GIRAIPLATIPLVPGTNASVSGWGQLSAMNPSSEVLLRVDVKIQDQLMCATNLALKG---- 169

  Fly   211 RITS-AMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGNSCALPNYPGVYANVAYLRPWID 274
            |:.| ..:||...| ....||||..||||...:.|||::||.::|.:.|...||||:|..:.||:
  Fly   170 RLMSVGEICAAPAG-EIPYACQGFVGGPLVANNRLYGILSWQSACDVLNKSSVYANIAMFKVWIE 233

  Fly   275 AVL 277
            :.:
  Fly   234 STV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 78/238 (33%)
Tryp_SPc 39..276 CDD:238113 80/240 (33%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 79/232 (34%)
Tryp_SPc 24..232 CDD:214473 77/229 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.