DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG17234

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster


Alignment Length:260 Identity:94/260 - (36%)
Similarity:132/260 - (50%) Gaps:52/260 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQ-----Y 97
            ||:||....|.|||:|:||:|.|        .|.|||||::|..|||||||......::     |
  Fly    26 RIIGGEPIGIEQVPWQVSLQYFG--------DHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGY 82

  Fly    98 KVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYN---NDIAILFVDPPLPLNNFT--IKAIKLA 157
            :|.||:.. |.|:|.:.:|..:::||.|    |::   |||||:.:..||   .||  ::.|.||
  Fly    83 QVRAGSAL-TDSNGTLVDVAALIIHEEY----AFDLNINDIAIVRLSTPL---EFTSKVQPIPLA 139

  Fly   158 LEQPIEGTVSKVSGWGTTSPGGYSSN------QLLAVDV-PIVSNELCDQDYEDFGDETYRITSA 215
            ...|...:::.|||||.:.....|:|      |.||:.: .|.|..|.|              .:
  Fly   140 KTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRLFD--------------PS 190

  Fly   216 MLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGNSCALPNYPGVYANVAYLRPWIDAVLAGL 280
            :|||   |..|..||.|||||||.|..:|.||||||....:.:  ..:.:|.|.|.||...:|.:
  Fly   191 LLCA---GTYGRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSS--AFFVSVPYFREWILNAIASI 250

  Fly   281  280
              Fly   251  250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 91/251 (36%)
Tryp_SPc 39..276 CDD:238113 92/253 (36%)
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 91/251 (36%)
Tryp_SPc 27..243 CDD:238113 90/250 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443240
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.