DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and AgaP_AGAP001251

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_001689373.2 Gene:AgaP_AGAP001251 / 5667665 VectorBaseID:AGAP001251 Length:290 Species:Anopheles gambiae


Alignment Length:255 Identity:72/255 - (28%)
Similarity:118/255 - (46%) Gaps:49/255 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIG 91
            :||   :||...|.||.:..|...|||:|||.:|        .|.||.|:..|...::||||:  
Mosquito    55 QDL---NVPSPFIFGGESVAIESYPYQLSLRLEG--------THICGASVIAERWALSAAHCL-- 106

  Fly    92 TVASQYKVVAGTNFQTG-----SDGVITNVKEIVMHEGYYSGAAYNNDIAI------LFVDPPLP 145
               .:....:...|:.|     :.|.|.:.:..::|. .:.....:.|:::      .|:||   
Mosquito   107 ---DEALYPSAITFRGGTPHRLAGGYIFHAEYYLLHP-KFDRRTLDYDVSVTHVRESFFIDP--- 164

  Fly   146 LNNFTIKAIKLA---LEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGD 207
                 |:|:.||   ...||. :.:.|:|||.....||....|.::::.:...:.|      :..
Mosquito   165 -----IRAVTLANTNTYYPIP-SAAVVTGWGLADADGYEPLILQSLEIYLQQKQFC------WTS 217

  Fly   208 ETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWG-NSCALPNYPGVYANV 266
            ....:|...:|.|. ||.|.:.|.|||||||.:.....|:|||| ::||: |.||:|.::
Mosquito   218 TIEALTDRQICGGS-GVYGKETCYGDSGGPLVMNGYQVGIVSWGSDNCAV-NIPGIYTSL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 68/244 (28%)
Tryp_SPc 39..276 CDD:238113 68/243 (28%)
AgaP_AGAP001251XP_001689373.2 Tryp_SPc 64..277 CDD:214473 68/243 (28%)
Tryp_SPc 64..277 CDD:238113 68/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.