DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and AgaP_AGAP001250

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_001689374.2 Gene:AgaP_AGAP001250 / 5667664 VectorBaseID:AGAP001250 Length:279 Species:Anopheles gambiae


Alignment Length:251 Identity:77/251 - (30%)
Similarity:112/251 - (44%) Gaps:46/251 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIG-TV 93
            |.||   .|||||....|...|||:|||..|:        |.||.|:.:....::||||... ..
Mosquito    48 DGKS---ARIVGGRDAPIENFPYQLSLRRSGV--------HACGASVISLRWALSAAHCTYPIPQ 101

  Fly    94 ASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAIL---------FVDP---PLPL 146
            .::..:.||::.:. :.|.|..:.:|:.|. .:|......|:.:|         |:.|   |...
Mosquito   102 MNEMSLRAGSSNRL-AGGTIIPITQIINHP-LFSEYTIEYDVCVLQTSTEMVGQFIVPVVLPPAT 164

  Fly   147 NNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYR 211
            :.|.            .||::..:|||..:..|....||..|.:|::|.:.|...:     .:..
Mosquito   165 SGFA------------PGTMANATGWGLLNVPGSLPVQLQYVALPLISLDQCRNSW-----PSEW 212

  Fly   212 ITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGNSCALPNYPGVYANVA 267
            ||..|||||:   .|.|.|.|||||||.:.....|:.|||.|....|.|.|:||.|
Mosquito   213 ITEEMLCAGQ---PGRDTCGGDSGGPLVINGYQMGIASWGVSECSGNLPSVFANTA 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 74/243 (30%)
Tryp_SPc 39..276 CDD:238113 73/242 (30%)
AgaP_AGAP001250XP_001689374.2 Tryp_SPc 53..273 CDD:214473 74/243 (30%)
Tryp_SPc 54..273 CDD:238113 73/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.