DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and AgaP_AGAP005688

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_001688707.1 Gene:AgaP_AGAP005688 / 5667341 VectorBaseID:AGAP005688 Length:301 Species:Anopheles gambiae


Alignment Length:301 Identity:84/301 - (27%)
Similarity:124/301 - (41%) Gaps:49/301 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VGLLAFLVSLVALT---QGLPLLEDLD--------EKSV-----PDGRIVGGYATDIAQVPYQIS 55
            |.|||.|||...:.   :.:..:||.|        |..:     |..||..|......|.||||.
Mosquito     8 VSLLATLVSANWIEIDWRKVRSIEDFDHYWDRLPTEMKIYRQRRPFQRITNGQEATPGQFPYQII 72

  Fly    56 LRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVI---GTVASQYKVVAGTN---FQTGSDGVIT 114
            |.....|...     .||||:.....|:||||||:   .||.|....:.|.:   .|..|...|.
Mosquito    73 LLSDFPTGTA-----LCGGSVLTRNFILTAAHCVVSGTNTVVSGGIAIMGAHNRTIQEASQQRIR 132

  Fly   115 NVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFT--IKAIKLALE---QPIEGTVSKVSGWGT 174
            .....:.:...|..:....|||::.::..:   .||  |:.::|..:   :...|.|..:||:|.
Mosquito   133 YTASGIRYHPLYVSSTLRYDIAVVLLNSSI---TFTDRIQPVRLPAQSDTRQFGGFVGTLSGFGR 194

  Fly   175 TSPGGYS-SNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPL 238
            |:....| |..:.....|:::|..|   ...:|..  .|....:|..  |.||..:|.|||||||
Mosquito   195 TTDASQSISTVVRFTSNPVMTNANC---ITRWGSS--NIQDQNVCLS--GTGGRSSCNGDSGGPL 252

  Fly   239 AVRDE---LYGVVSWGN--SCALPNYPGVYANVAYLRPWID 274
            .|...   ..||||:.:  .|. ...|.||:.|::...|::
Mosquito   253 TVESGGPIQIGVVSFVSIRGCE-AGMPSVYSRVSFYLNWVE 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 71/251 (28%)
Tryp_SPc 39..276 CDD:238113 71/253 (28%)
AgaP_AGAP005688XP_001688707.1 Tryp_SPc 55..291 CDD:214473 71/251 (28%)
Tryp_SPc 56..292 CDD:238113 71/251 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.