DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and AgaP_AGAP006485

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_001688885.1 Gene:AgaP_AGAP006485 / 5667297 VectorBaseID:AGAP006485 Length:281 Species:Anopheles gambiae


Alignment Length:276 Identity:69/276 - (25%)
Similarity:112/276 - (40%) Gaps:36/276 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LVALTQGLPLLE-DLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNE 79
            ::.|...||.:. |..|......|::||......|.|..:|:.    ||    |...|||::.:.
Mosquito     7 VLCLAVALPCIRGDNVESEDRSPRLIGGTNAPWGQFPSAVSIN----TT----FNVHCGGAVVDR 63

  Fly    80 TTIVTAAHCVIGT---VASQYKVV----------AGTNFQTGSDGVITNVKEIVMHEGYYSGAAY 131
            ..::|||.||...   :...|.:.          .|...||      ..|..|.:|. .::....
Mosquito    64 QHVLTAAQCVFNANLRLVDPYWITVRAGDIALAPVGARRQT------RKVSHIFVHP-QFNIRTL 121

  Fly   132 NNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSN- 195
            .:|:|:|.:|.|..|.:.||............|...:.:|||.::....:...:|...:|:..| 
Mosquito   122 EHDVAVLRLDRPYDLPSNTINLANRTRRIVPNGASCQFAGWGASTAALNAPVNVLQRFLPMTVND 186

  Fly   196 -ELCDQDYEDFGDETYRITSAMLCAGKR-GVGGADACQGDSGGPLAVRDELYGVVSWGNSCALPN 258
             ::|:|.....|    |:..:.||||.. |...|..|.|::|..|.....|.|.:|:|.:|...|
Mosquito   187 RDMCNQANMHAG----RMLESHLCAGNTGGSNNAAPCNGNAGTGLYCERALVGTLSFGLNCGAAN 247

  Fly   259 YPGVYANVAYLRPWID 274
            .|.|:..|.:...||:
Mosquito   248 NPPVFTQVRFYNDWIE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 62/250 (25%)
Tryp_SPc 39..276 CDD:238113 63/252 (25%)
AgaP_AGAP006485XP_001688885.1 Tryp_SPc 30..262 CDD:214473 62/250 (25%)
Tryp_SPc 32..265 CDD:238113 63/251 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.