DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and PRSS1

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens


Alignment Length:247 Identity:92/247 - (37%)
Similarity:123/247 - (49%) Gaps:27/247 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVV 100
            |.:|||||..:...||||:||         |...|.||||:.||..:|:|.||    ..|:.:|.
Human   246 DDKIVGGYNCEENSVPYQVSL---------NSGYHFCGGSLINEQWVVSAGHC----YKSRIQVR 297

  Fly   101 AGT-NFQT--GSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPI 162
            .|. |.:.  |::..| |..:|:.|. .|.....||||.::.:.....: |..:..|.|....|.
Human   298 LGEHNIEVLEGNEQFI-NAAKIIRHP-QYDRKTLNNDIMLIKLSSRAVI-NARVSTISLPTAPPA 359

  Fly   163 EGTVSKVSGWG-TTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGG 226
            .||...:|||| |.|.|....::|..:|.|::|...|:..|..      :|||.|.|.|.. .||
Human   360 TGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPG------KITSNMFCVGFL-EGG 417

  Fly   227 ADACQGDSGGPLAVRDELYGVVSWGNSCALPNYPGVYANVAYLRPWIDAVLA 278
            .|:||||||||:....:|.||||||:.||..|.||||..|.....||...:|
Human   418 KDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIA 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 88/238 (37%)
Tryp_SPc 39..276 CDD:238113 90/240 (38%)
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 88/238 (37%)
Tryp_SPc 249..467 CDD:238113 90/240 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.