DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and zmp:0000001088

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_688573.1 Gene:zmp:0000001088 / 560086 ZFINID:ZDB-GENE-140106-48 Length:263 Species:Danio rerio


Alignment Length:282 Identity:101/282 - (35%)
Similarity:150/282 - (53%) Gaps:44/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCG 73
            ||..|:.::|::.          :.|...||||||      ||...|::|. ::......:|.||
Zfish     7 LLCVLLEILAVSC----------QDVIQARIVGGY------VPAPYSIKYI-VSIQSATGQHFCG 54

  Fly    74 GSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVITNVKE------IVMHEGYYSGAAYN 132
            |::.|:..::|||||.||  .:..::|||..    |.|:...:::      ::.|. .|..:..|
Zfish    55 GTLINKYWVLTAAHCNIG--EANMRIVAGDY----SVGLYEGMEQFRRPHMLIPHP-QYDRSTNN 112

  Fly   133 NDIAILFVDPPLPLNNFTIKAIKLALEQPI--EGTVSKVSGWG-TTSPGGYSSNQLLAVDVPIVS 194
            .||.::.:..|:.||:: :..:.|..:..:  .|.:..||||| |||.||.|| .|..|.:||||
Zfish   113 ADIMLIKLQSPVYLNSY-VSLVPLPRQDAMVAVGRLCSVSGWGFTTSTGGISS-ILRTVKLPIVS 175

  Fly   195 NELCDQDYEDFGDETY--RITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGNSCALP 257
            ..:|:      |.:::  .||..|:||| ...||.|||:|||||||.....:||:|||||.||..
Zfish   176 TAVCN------GTDSFNGNITENMICAG-YSTGGKDACKGDSGGPLVCEGRVYGIVSWGNGCADA 233

  Fly   258 NYPGVYANVAYLRPWIDAVLAG 279
            .|||||..|:..|.||||.:.|
Zfish   234 QYPGVYTAVSQFRQWIDATIFG 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 91/245 (37%)
Tryp_SPc 39..276 CDD:238113 93/247 (38%)
zmp:0000001088XP_688573.1 Tryp_SPc 26..249 CDD:214473 91/245 (37%)
Tryp_SPc 27..252 CDD:238113 93/247 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.