DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and KLK15

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:284 Identity:85/284 - (29%)
Similarity:130/284 - (45%) Gaps:51/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WIVGLLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFR 69
            |::..|:||::..|...|..|||  .::..|..:            |:|::|..:|        |
Human     2 WLLLTLSFLLASTAAQDGDKLLE--GDECAPHSQ------------PWQVALYERG--------R 44

  Fly    70 HRCGGSIFNETTIVTAAHCVIGTVASQY-KVVAGTNFQTGSDG--VITNVKEIVMHEGYYSGAAY 131
            ..||.|:.:...:::||||     .|:: :|..|.:.....||  .:.....::.|. .|...::
Human    45 FNCGASLISPHWVLSAAHC-----QSRFMRVRLGEHNLRKRDGPEQLRTTSRVIPHP-RYEARSH 103

  Fly   132 NNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTS---PGGYSS--------NQL 185
            .|||.:|.:..|..||. .::...|....|..|....|||||..|   ||...|        :.|
Human   104 RNDIMLLRLVQPARLNP-QVRPAVLPTRCPHPGEACVVSGWGLVSHNEPGTAGSPRSQVSLPDTL 167

  Fly   186 LAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSW 250
            ...::.|:|:..||:.|..      |:|:.|:|||..| .||::|:|||||||.....|.|:|||
Human   168 HCANISIISDTSCDKSYPG------RLTNTMVCAGAEG-RGAESCEGDSGGPLVCGGILQGIVSW 225

  Fly   251 GN-SCALPNYPGVYANVAYLRPWI 273
            |: .|.....||||..|.:...||
Human   226 GDVPCDNTTKPGVYTKVCHYLEWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 73/249 (29%)
Tryp_SPc 39..276 CDD:238113 75/250 (30%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 74/257 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.