DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and cfd

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001018368.1 Gene:cfd / 553553 ZFINID:ZDB-GENE-050522-411 Length:249 Species:Danio rerio


Alignment Length:241 Identity:73/241 - (30%)
Similarity:118/241 - (48%) Gaps:22/241 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 IVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGT 103
            |.||........||..|:::.|        :|.|||.:.:...:::||||......|..|||.|.
Zfish    21 ITGGQEAKAHSRPYMASVQWNG--------KHECGGFLISSQWVMSAAHCFQDGRTSGVKVVLGA 77

  Fly   104 NFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQ---PIEGT 165
            :..:|::.........|.:...:|.:.|:||||::.:|.|:..:: .:|.:|...::   |.|..
Zfish    78 HSLSGAEDTKQTFDAEVYNHPDFSISNYDNDIALIKLDKPVTQSD-AVKPVKFQRDETADPKEAA 141

  Fly   166 VSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAG-KRGVGGADA 229
            |.:.:|||:.:..|...::|..:.:|::....|.:  .||..|  :.||.||||. ||    .|.
Zfish   142 VVETAGWGSLNNMGGRPDKLHELSIPVMERWRCGR--ADFYGE--KFTSNMLCAADKR----KDT 198

  Fly   230 CQGDSGGPLAVRDELYGVVS-WGNSCALPNYPGVYANVAYLRPWID 274
            |.|||||||..|..:.|:.| .|..|.....||:|..:::...|||
Zfish   199 CDGDSGGPLLYRGIVVGITSNGGKKCGSSRKPGLYTIISHYASWID 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 70/238 (29%)
Tryp_SPc 39..276 CDD:238113 73/241 (30%)
cfdNP_001018368.1 Tryp_SPc 21..246 CDD:238113 73/241 (30%)
Tryp_SPc 21..243 CDD:214473 70/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.