DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Cfd

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001071110.1 Gene:Cfd / 54249 RGDID:2498 Length:263 Species:Rattus norvegicus


Alignment Length:285 Identity:85/285 - (29%)
Similarity:133/285 - (46%) Gaps:52/285 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSI 76
            :||:||.|...:.:.:       |.|||:||........||..|::..|        .|.|||::
  Rat     6 YLVALVVLEAAVCVAQ-------PRGRILGGQEAMAHARPYMASVQVNG--------THVCGGTL 55

  Fly    77 FNETTIVTAAHCVIGTVASQ-YKVVAGTNFQTGSDGV--ITNVKEIVMHEGYYSGAAYNNDIAIL 138
            .:|..:::||||:.|....: .:|:.|.:..:..:..  :.:|:.:|:|.|....:.  .|..:|
  Rat    56 VDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSV--EDDLML 118

  Fly   139 F-------VDP---PLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIV 193
            |       :.|   ||||.. ..:.:|       .||:..|:|||..:..|...:.|..:.|.|:
  Rat   119 FKLSHNASLGPHVRPLPLQR-EDREVK-------PGTLCDVAGWGVVTHAGRRPDVLQQLTVSIM 175

  Fly   194 SNELCD-QDYEDFGDETYRITSAMLCA--GKRGVGGADACQGDSGGPLAVRDELYGVVSWGNS-C 254
            ....|: :.|.|..     ||..|:||  .:|     |.|:|||||||...|.:..||:||:. |
  Rat   176 DRNTCNLRTYHDGA-----ITKNMMCAESNRR-----DTCRGDSGGPLVCGDAVEAVVTWGSRVC 230

  Fly   255 ALPNYPGVYANVAYLRPWIDAVLAG 279
            .....|||:..||...|||:.||:|
  Rat   231 GNRRKPGVFTRVATYVPWIENVLSG 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 73/251 (29%)
Tryp_SPc 39..276 CDD:238113 74/253 (29%)
CfdNP_001071110.1 Tryp_SPc 26..252 CDD:238113 74/253 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.