DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and prss60.2

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:262 Identity:91/262 - (34%)
Similarity:131/262 - (50%) Gaps:42/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DGRIVGGYATDIAQVPYQISL---RYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQY 97
            :.|||||........|:|:||   ||.|         |.||||:.:...::|||||:.|...|..
Zfish    31 NSRIVGGVNAPEGSWPWQVSLQSPRYGG---------HFCGGSLISSEWVLTAAHCLPGVSESSL 86

  Fly    98 KVVAGTNFQTGSDGVIT--NVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQ 160
            .|..|...|.|.:...|  ||.:|::|..|.|. ..:||||:|.:...:..|:: |:.:.||.:.
Zfish    87 VVYLGRRTQQGVNTHETSRNVAKIIVHSSYNSN-TNDNDIALLRLSSAVTFNDY-IRPVCLAAQN 149

  Fly   161 PI--EGTVSKVSGWGTTSPG------GYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAML 217
            .:  .||.|.::|||....|      |.....:    :|:|:|:.|:   ...|..|  :|:.|:
Zfish   150 SVYSAGTSSWITGWGDVQAGVNLPAPGILQETM----IPVVANDRCN---AQLGSGT--VTNNMI 205

  Fly   218 CAGKRGVGGADACQGDSGGPLAVRDEL------YGVVSWGNSCALPNYPGVYANVAYLRPWIDAV 276
            ||| ...||.|.||||||||:..|  |      .|:.|||..||.||.||||..|:..:.||.:.
Zfish   206 CAG-LAKGGKDTCQGDSGGPMVTR--LCTVWIQAGITSWGYGCADPNSPGVYTRVSQYQSWISSK 267

  Fly   277 LA 278
            ::
Zfish   268 IS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 89/253 (35%)
Tryp_SPc 39..276 CDD:238113 90/255 (35%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 89/253 (35%)
Tryp_SPc 34..267 CDD:238113 90/255 (35%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.