DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Elane

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_056594.2 Gene:Elane / 50701 MGIID:2679229 Length:265 Species:Mus musculus


Alignment Length:277 Identity:72/277 - (25%)
Similarity:111/277 - (40%) Gaps:60/277 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNET 80
            |:||..|.|.|.         ..||||........|:..||:.:|        .|.||.::....
Mouse    15 LLALFLGGPALA---------SEIVGGRPARPHAWPFMASLQRRG--------GHFCGATLIARN 62

  Fly    81 TIVTAAHCVIGTVASQYKVVAGTN--------FQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAI 137
            .:::|||||.|......:||.|.:        .||.|      |:.|  .|..:..:...|||.|
Mouse    63 FVMSAAHCVNGLNFRSVQVVLGAHDLRRQERTRQTFS------VQRI--FENGFDPSQLLNDIVI 119

  Fly   138 LFVDPPLPLNNFTIKAIKLALEQPIEG------TVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNE 196
            :.::     .:.||.|.....:.|.:|      |.....|||.......|.:.|..::|.:|:| 
Mouse   120 IQLN-----GSATINANVQVAQLPAQGQGVGDRTPCLAMGWGRLGTNRPSPSVLQELNVTVVTN- 178

  Fly   197 LCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSW-GNSCALPNYP 260
            :|.:          |:....|...::    |..|.|||||||...:.:.|:.|: ...|....||
Mouse   179 MCRR----------RVNVCTLVPRRQ----AGICFGDSGGPLVCNNLVQGIDSFIRGGCGSGLYP 229

  Fly   261 GVYANVAYLRPWIDAVL 277
            ..:|.||....||::::
Mouse   230 DAFAPVAEFADWINSII 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 64/249 (26%)
Tryp_SPc 39..276 CDD:238113 66/251 (26%)
ElaneNP_056594.2 Tryp_SPc 28..242 CDD:214473 64/249 (26%)
Tryp_SPc 29..245 CDD:238113 66/251 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.