DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Prss44

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_008764869.1 Gene:Prss44 / 501060 RGDID:1560940 Length:373 Species:Rattus norvegicus


Alignment Length:248 Identity:91/248 - (36%)
Similarity:129/248 - (52%) Gaps:30/248 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RIVGGYATDIAQVPYQISLR-YKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVA 101
            |||||....|.:.|:|:||: :|         :|.||||:.::..::||||||.|.:  .|.|..
  Rat   112 RIVGGKPAPIRKWPWQVSLQVHK---------QHICGGSLISKWWVMTAAHCVYGHL--DYVVSM 165

  Fly   102 GTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLN-NFTIKAI----KLALEQP 161
            |......|..|...|::|::|:.|.......:|||::.:  ..|:| :..|:.:    |..|.||
  Rat   166 GEADLWSSMSVKIPVQDIIVHQDYSVMRTIVHDIALVLL--AFPVNYSVNIQPVCIPEKSFLVQP 228

  Fly   162 IEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVG- 225
              ||:..|:|||.|...|.||..|..||:.|:.:|.|:|..:|.   |.||.:.:...|..|.. 
  Rat   229 --GTLCWVTGWGKTIERGRSSRVLREVDLSIIRHERCNQILKDI---TGRIFTLVQEGGVCGYNK 288

  Fly   226 -GADACQGDSGGPLAVRDE----LYGVVSWGNSCALPNYPGVYANVAYLRPWI 273
             |.||||||||||:.....    ..|:||||..|....|||:|..|:|.|.||
  Rat   289 KGGDACQGDSGGPMVCEFNKTWVQVGIVSWGLGCGRIGYPGIYTEVSYYRDWI 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 89/246 (36%)
Tryp_SPc 39..276 CDD:238113 90/247 (36%)
Prss44XP_008764869.1 Tryp_SPc 112..341 CDD:214473 89/246 (36%)
Tryp_SPc 113..341 CDD:238113 88/245 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.