DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Prss53

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:350 Identity:84/350 - (24%)
Similarity:127/350 - (36%) Gaps:116/350 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSSWIVGLLAFLVSLVALTQGLPLLEDLDEKSVP------DGRIVGGYATDIAQVPYQISLRYK 59
            |..||...||  :|..|.:.:||...:....:..|      :|..:.|      :.|:|.|:|.:
  Rat     1 MRQSWGPELL--IVGAVIVIEGLQAAQRACGQRGPGPPEPQEGNTLPG------EWPWQASVRRQ 57

  Fly    60 GITTPENPFRHRCGGSIFNETTIVTAAHC---VIGTVASQYKVVAGTNFQTGSDGVITNVKEIVM 121
            |:        |.|.||:..:|.::|||||   :.....|.:.||.|:                :.
  Rat    58 GV--------HICSGSLVADTWVLTAAHCFEKMATAELSSWSVVLGS----------------LK 98

  Fly   122 HEGYYSGA------------AYN-----NDIAILFVDPPLPLNNFTIKAIKLALEQPIE----GT 165
            .||...||            |||     :|:|:|.:..|       |....|.|.||..    |.
  Rat    99 QEGLSPGAEEVGVAALQLPKAYNHYSQGSDLALLQLTHP-------IVHTTLCLPQPTHHFPFGA 156

  Fly   166 VSKVSGWG-TTSPGGYS------------------------------------SNQLLAVDVPIV 193
            ....:||. .||.|.|.                                    |..|..:.:.::
  Rat   157 SCWATGWDQNTSDGKYCPRHKSRESQTGSVLTVLALCSHCVSELDSTLSPLPVSRTLRNLRLRLI 221

  Fly   194 SNELCDQDYEDFGDETYR--ITSAMLCAGKR-GVGGADACQGDSGGPLAVRDE-----LYGVVSW 250
            |...|:..|.........  ..|.|||.|.: ||.|  .||||||||:..|:.     ..|::|:
  Rat   222 SRPTCNCLYNRLHQRLLANPARSGMLCGGAQPGVQG--PCQGDSGGPVMCREPDGHWVQVGIISF 284

  Fly   251 GNSCALPNYPGVYANVAYLRPWIDA 275
            .::||..:.|.:..::|....|:.|
  Rat   285 TSNCAQEDTPVLLTDMAAHSSWLQA 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 71/303 (23%)
Tryp_SPc 39..276 CDD:238113 72/305 (24%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113 72/303 (24%)
Tryp_SPc 341..561 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343323
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.