DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and try10

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001011209.1 Gene:try10 / 496640 XenbaseID:XB-GENE-6453489 Length:243 Species:Xenopus tropicalis


Alignment Length:270 Identity:105/270 - (38%)
Similarity:138/270 - (51%) Gaps:38/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIF 77
            |.||:.|....| :||       |.:|||||.   ..||||:||         |...|.||||:.
 Frog     6 LFSLLGLAVAQP-IED-------DDKIVGGYH---CSVPYQVSL---------NAGYHFCGGSLI 50

  Fly    78 NETTIVTAAHCVIGTVASQYKVVAGTN---FQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILF 139
            ||..:|:||||    ..|:.::..|.|   ...|::..|.:.| |:.|..|.|. ..:|||.::.
 Frog    51 NEHWVVSAAHC----YQSKMELRIGENNIELLEGTEQFIQSAK-IIRHPQYNSW-TIDNDIMLIQ 109

  Fly   140 VDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLL-AVDVPIVSNELCDQDYE 203
            :..|..||| .::.|.|..|.|..|::..:||||.|...|.:...|| .::.||:|::.|.|.|.
 Frog   110 LQEPAQLNN-EVQPIPLPTECPPVGSICLISGWGNTLSNGVNYPDLLQCIEAPILSDQECRQSYP 173

  Fly   204 DFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGNSCALPNYPGVYANVAY 268
            .      .||..|:|.|.. .||.|:||||||||:....||.||||||..||||.|||||..|..
 Frog   174 G------SITDNMICVGYL-EGGIDSCQGDSGGPVVCDGELQGVVSWGRGCALPGYPGVYTKVCN 231

  Fly   269 LRPWIDAVLA 278
            ...||...:|
 Frog   232 YLSWIRDTIA 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 94/238 (39%)
Tryp_SPc 39..276 CDD:238113 96/240 (40%)
try10NP_001011209.1 Tryp_SPc 24..239 CDD:238113 96/240 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.