DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and sdhaf4

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001008179.1 Gene:sdhaf4 / 493541 XenbaseID:XB-GENE-1007482 Length:118 Species:Xenopus tropicalis


Alignment Length:100 Identity:20/100 - (20%)
Similarity:30/100 - (30%) Gaps:41/100 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 IKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSA 215
            ||..|..|::|            ||..|.:..::...::    .|.|     |.|.|:...:|. 
 Frog    51 IKGTKQPLKKP------------TTPQGKFDDSEQTTLE----KNPL-----EKFPDDINPVTK- 93

  Fly   216 MLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSW 250
                             :.|||.......||  .|
 Frog    94 -----------------EKGGPRGPEPTRYG--DW 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 19/99 (19%)
Tryp_SPc 39..276 CDD:238113 19/99 (19%)
sdhaf4NP_001008179.1 DUF1674 76..118 CDD:311723 11/62 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.