DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and ACR

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001088.2 Gene:ACR / 49 HGNCID:126 Length:421 Species:Homo sapiens


Alignment Length:297 Identity:96/297 - (32%)
Similarity:134/297 - (45%) Gaps:53/297 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLAFLVSLVALTQ-------GLPLLEDLDEKSVPDG--RIVGGYATDIAQVPYQISLRYKGITTP 64
            ||...||:||...       ||...::      |.|  |||||.|......|:.:||:   |.|.
Human    10 LLVLAVSVVAKDNATCDGPCGLRFRQN------PQGGVRIVGGKAAQHGAWPWMVSLQ---IFTY 65

  Fly    65 ENPFRHRCGGSIFNETTIVTAAHCVIG--------TVASQYKVVAGTNFQTGSDGVITNVKEIVM 121
            .:...|.||||:.|...::|||||.:|        .|....::..|.|....:......|::|::
Human    66 NSHRYHTCGGSLLNSRWVLTAAHCFVGKNNVHDWRLVFGAKEITYGNNKPVKAPLQERYVEKIII 130

  Fly   122 HEGYYSGAAYNNDIAILFVDPPLPLNNF----TIKAIKLALEQPIEGTVS-KVSGWG-TTSPGGY 180
            ||.|.| |...||||::.:.||:....|    .:...|..|.:   |:.| .|:||| .......
Human   131 HEKYNS-ATEGNDIALVEITPPISCGRFIGPGCLPHFKAGLPR---GSQSCWVAGWGYIEEKAPR 191

  Fly   181 SSNQLLAVDVPIVSNELCD--QDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDE 243
            .|:.|:...|.::..:||:  |.|..      |:....:||| ..||..|.|||||||||..:|.
Human   192 PSSILMEARVDLIDLDLCNSTQWYNG------RVQPTNVCAG-YPVGKIDTCQGDSGGPLMCKDS 249

  Fly   244 ------LYGVVSWGNSCALPNYPGVY-ANVAYLRPWI 273
                  :.|:.|||..||....||:| |...||. ||
Human   250 KESAYVVVGITSWGVGCARAKRPGIYTATWPYLN-WI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 84/257 (33%)
Tryp_SPc 39..276 CDD:238113 85/258 (33%)
ACRNP_001088.2 Tryp_SPc 42..285 CDD:214473 84/257 (33%)
Tryp_SPc 43..288 CDD:238113 85/258 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..316
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..383
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..421
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.