DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and betaTry

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster


Alignment Length:270 Identity:121/270 - (44%)
Similarity:154/270 - (57%) Gaps:26/270 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLAFLV--SLVALTQGLPLLEDLDEKSVP--DGRIVGGYATDIAQVPYQISLRYKGITTPENPFR 69
            :|.||:  |.||...|..:.|.|    :|  |||||||.||.|:..|:||||:..|        .
  Fly     1 MLKFLILLSAVACALGGTIPEGL----LPQLDGRIVGGTATTISSFPWQISLQRSG--------S 53

  Fly    70 HRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNND 134
            |.|||||::...|||||||:....||..::.||:::.: |.||:..|.....||||.:.... ||
  Fly    54 HSCGGSIYSARVIVTAAHCLQSVSASSLQIRAGSSYWS-SGGVVAKVSSFKNHEGYNANTMV-ND 116

  Fly   135 IAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYS-SNQLLAVDVPIVSNELC 198
            ||:|.:...|..:: |||||.||...|..|..:.||||||.|.|..| .:||..|:|.|||...|
  Fly   117 IAVLHLSSSLSFSS-TIKAIGLASSNPANGAAASVSGWGTESSGSSSIPSQLRYVNVNIVSQSRC 180

  Fly   199 DQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGNSCALPNYPGVY 263
            ......:|::   |.|:|:||   ...|.|:|||||||||.....|.||||||..||..||||||
  Fly   181 SSSSYGYGNQ---IKSSMICA---FASGKDSCQGDSGGPLVSGGVLVGVVSWGYGCAAANYPGVY 239

  Fly   264 ANVAYLRPWI 273
            |:||.||.|:
  Fly   240 ADVAALRSWV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 108/235 (46%)
Tryp_SPc 39..276 CDD:238113 108/236 (46%)
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 108/235 (46%)
Tryp_SPc 31..252 CDD:238113 108/236 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443243
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.