DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and AgaP_AGAP010240

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_001238153.2 Gene:AgaP_AGAP010240 / 4578338 VectorBaseID:AGAP010240 Length:275 Species:Anopheles gambiae


Alignment Length:283 Identity:90/283 - (31%)
Similarity:128/283 - (45%) Gaps:36/283 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLAFLVSLVALTQGLP---LLEDLDEKSVP------DGRIVGGYATDIAQVPYQISLRYKGITTP 64
            ::..|..|.|:...||   ..|...:..||      ..|||.|:...:.|.|||:.|...|... 
Mosquito     5 IVVVLACLAAVQVRLPPQNAREISYQSIVPFREATRSSRIVNGFPASLGQFPYQVFLIGDGSLA- 68

  Fly    65 ENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGA 129
                   ||||:.:...::|||||.:|  .||:.|.|| :.|..|.|.:.....|::|.. |:.:
Mosquito    69 -------CGGSLISAEWVLTAAHCQVG--ISQFTVRAG-SIQNNSGGTVRTSNLIIIHPN-YNPS 122

  Fly   130 AYNNDIAILFVDPPLPL-NNFTIKAIKLA-LEQPIEGTVSKVSGWGTTS-PGGYSSNQLLAVDVP 191
            ..||||.::.::.|:|| .|..:.|:..| |.:......:.|||:|.|| ..|..|..|..|.:.
Mosquito   123 NLNNDIGLIRLNEPMPLGGNIQVVALPEANLSETFLNREATVSGFGRTSDASGAISPNLNFVHLN 187

  Fly   192 IVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDE----LYGVVSW-- 250
            |:||..|...|   |..|  |..:.:||..|.......|.|||||||.|.:.    ..||||:  
Mosquito   188 IISNIQCMGTY---GSAT--IIDSTVCAVGRDAPNQGTCNGDSGGPLTVTENGQSVQIGVVSFVA 247

  Fly   251 GNSCALPNYPGVYANVAYLRPWI 273
            ...|.: .:|..|....:.|.||
Mosquito   248 AAGCEV-GFPSGYVRTTHFRNWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 80/243 (33%)
Tryp_SPc 39..276 CDD:238113 81/244 (33%)
AgaP_AGAP010240XP_001238153.2 Tryp_SPc 43..269 CDD:214473 80/243 (33%)
Tryp_SPc 44..272 CDD:238113 81/244 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.