powered by:
Protein Alignment zetaTry and AgaP_AGAP008995
DIOPT Version :9
Sequence 1: | NP_523691.1 |
Gene: | zetaTry / 36216 |
FlyBaseID: | FBgn0011556 |
Length: | 280 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_001238187.2 |
Gene: | AgaP_AGAP008995 / 4578167 |
VectorBaseID: | AGAP008995 |
Length: | 237 |
Species: | Anopheles gambiae |
Alignment Length: | 31 |
Identity: | 12/31 - (38%) |
Similarity: | 15/31 - (48%) |
Gaps: | 3/31 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 148 NFTIKAIKLALEQPIEGTVSKVSGWGTTSPG 178
|.|:.:...||....|.|.|.|| :||.|
Mosquito 8 NLTVTSTAGALAATTESTPSSVS---STSEG 35
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
zetaTry | NP_523691.1 |
Tryp_SPc |
38..273 |
CDD:214473 |
12/31 (39%) |
Tryp_SPc |
39..276 |
CDD:238113 |
12/31 (39%) |
AgaP_AGAP008995 | XP_001238187.2 |
DUF4551 |
<96..>187 |
CDD:291746 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.