DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and AgaP_AGAP010619

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_001230717.2 Gene:AgaP_AGAP010619 / 4577722 VectorBaseID:AGAP010619 Length:280 Species:Anopheles gambiae


Alignment Length:254 Identity:82/254 - (32%)
Similarity:116/254 - (45%) Gaps:55/254 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGS 75
            |.||....:|:.        |.:...|||:.|:|:|||..|:.||:|..|        :..|||:
Mosquito    31 AVLVKAENVTEA--------EAAAQSGRIINGFASDIANYPFAISVRRDG--------QFYCGGT 79

  Fly    76 IFNETTIVTAAHCVIGTVASQYK---VVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYN-ND-- 134
            :.:.:..:|||     |....|:   .:.|.:....|.||:..|..|.:|      ..:| ||  
Mosquito    80 VISASYALTAA-----TPVYPYRNSITLYGGSTSANSGGVLFKVLMIAVH------LLFNPNDRV 133

  Fly   135 ----IAILFVDPPLPLNNF----TIKAIKLALEQPIEGTVSKVSGWGTTS---PGGYSSNQLLAV 188
                ||||.|    |.|.|    .|..|.||..:...||...|.|||.|:   ||  .:|.|.:.
Mosquito   134 SDYNIAILTV----PANAFGGRRNIAPIPLASAEVAIGTKCTVFGWGRTNANLPG--PANALRSA 192

  Fly   189 DVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGV 247
            |:.|.|...|.:.:   |..:.::||.|:||  :||.|||.|.||.|..|..|.:|.|:
Mosquito   193 DMVISSGATCARAW---GPLSVQLTSNMICA--KGVRGADLCIGDYGNALVCRGKLNGI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 76/227 (33%)
Tryp_SPc 39..276 CDD:238113 75/226 (33%)
AgaP_AGAP010619XP_001230717.2 Tryp_SPc 50..268 CDD:214473 76/227 (33%)
Tryp_SPc 51..268 CDD:238113 75/226 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.