DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and AgaP_AGAP010620

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_001230718.2 Gene:AgaP_AGAP010620 / 4577717 VectorBaseID:AGAP010620 Length:262 Species:Anopheles gambiae


Alignment Length:253 Identity:80/253 - (31%)
Similarity:114/253 - (45%) Gaps:30/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FLVSLVALTQ-GLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGS 75
            ||||...|.. |   |.::.|.:...|||:.|::.:||:.|:.:|||..|        :..||.:
Mosquito     4 FLVSSFVLRNCG---LSEIPEAAAQSGRIINGFSVEIAKYPFVLSLRRDG--------KFDCGAT 57

  Fly    76 IFNETTIVTAAHCVIGTVAS-QYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNN-DIAIL 138
            :.:.:..:|||..:.....| |...:.|.:....|.||..:|..|.:|..|......:: :||:|
Mosquito    58 VISLSHALTAAASIYPYRNSPQRMTLYGGSTSPTSGGVSFSVLRIAVHPNYNPIVRVSDFNIAVL 122

  Fly   139 FVDPPLPLNNF----TIKAIKLALEQPIEGTVSKVSGWGTTS---PGGYSSNQLLAVDVPIVSNE 196
            .|    |.|.|    .|..|.||......||...|.|||:|:   |.  .:..|.|.|:.|.|..
Mosquito   123 TV----PTNAFRAKRNIAPIPLASSVVETGTKCSVFGWGSTNYYIPA--PATTLRAADMVISSEA 181

  Fly   197 LCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGNSC 254
            .|.:.:........ |||.|:||  :|..|||.|.||||..|.....|.||....|:|
Mosquito   182 TCARAWLQLPSPVV-ITSNMVCA--KGDRGADLCTGDSGNALVCSGRLTGVAILSNTC 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 71/226 (31%)
Tryp_SPc 39..276 CDD:238113 70/225 (31%)
AgaP_AGAP010620XP_001230718.2 Tryp_SPc 28..256 CDD:214473 71/226 (31%)
Tryp_SPc 29..259 CDD:238113 70/225 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.