DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and prtn3

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001006847.1 Gene:prtn3 / 448597 XenbaseID:XB-GENE-5805214 Length:245 Species:Xenopus tropicalis


Alignment Length:244 Identity:68/244 - (27%)
Similarity:106/244 - (43%) Gaps:35/244 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAG 102
            :||||........||..||:.:|        ||.||||:.....::|||||:..|.::...||.|
 Frog    25 QIVGGREATPNSHPYIASLQLRG--------RHFCGGSLIAPQFLMTAAHCMENTASNLVTVVLG 81

  Fly   103 TNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKL--ALEQPIEGT 165
            .:....::......:...:.|..::.....|||.||.:|.|:.||. .::.:.|  |.|....||
 Frog    82 AHSLRANEATKQRFRVNQVFENGFNPLTLQNDIVILKLDRPVSLNG-KVQVVSLPSANEDVPAGT 145

  Fly   166 VSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAG----KRGVGG 226
            ....:|||..|..|...::|..::|.:....||..:              .:|.|    :.|:  
 Frog   146 QCVTAGWGRLSTEGQIPDRLQELNVTVTRQNLCRPN--------------NICTGVFMQQAGI-- 194

  Fly   227 ADACQGDSGGPLAVRDELYGVVSW-GNSCALPNYPGVYANVAYLRPWID 274
               |.|||||||.....:.|:.|: ..||.....|..::.|:..|.:||
 Frog   195 ---CFGDSGGPLVCNGVIQGITSFIIRSCGNGVTPDFFSRVSLFRRFID 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 66/241 (27%)
Tryp_SPc 39..276 CDD:238113 68/243 (28%)
prtn3NP_001006847.1 Tryp_SPc 26..241 CDD:238113 68/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.